Peritrich nuclear code explained

The peritrich nuclear code (translation table 30) is a genetic code used by the nuclear genome of the peritrich ciliates Vorticella and Opisthonecta.^[1]

The code (30)

   [[Amino acid|AAs]] = FFLLSSSSYYEECC*WLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

[[Start codon|Starts]] = --------------*--------------------M----------------------------

 [[DNA#Nucleobase_classification|Base1]] = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).

See also

• List of all genetic codes: translation tables 1 to 16, and 21 to 31.
• The genetic codes database.

References

^[2]

Notes and References

1. Sánchez-Silva. Rocı́o. Villalobo. Eduardo. Morin. Loı̈c. Torres. Antonio. 2003. A New Noncanonical Nuclear Genetic Code. Current Biology. 13. 5. 442–447. 10.1016/s0960-9822(03)00126-x. 12620196. 17484731. free.
2. Web site: Andrzej . Elzanowski . Jim . Ostell . Detlef . Leipe . Vladimir . Soussov . vanc . The Genetic Codes. 18 November 2016 . Taxonomy browser . National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine .