Grammotoxin Explained

Grammotoxin is a toxin in the venom of the tarantula Grammostola spatulata. It is a protein toxin that inhibits P-, Q- and N-type voltage-gated calcium channels (Ca 2+ channels) in neurons. Grammotoxin is also known as omega-grammotoxin SIA.

Chemistry

Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30.

It forms an inhibitor cystine knot motif, common in spider toxins.

Its chemical formula is: C177H268N52O50S6[1]

Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.[2]

Mode of action

The toxin binding site on the channels has high affinity for the toxins when they are closed and low affinity when channels are activated.[3] As a result, the toxin preferentially binds to the closed channels. It binds at a region which contains the voltage-sensing domains. When bound, the toxin makes it more difficult for channels to be opened by depolarization, so much larger depolarizations are required for channel activation.[3] Grammotoxin also binds to potassium channels but with lower affinity than to the calcium channels.

Notes and References

  1. http://www.sigmaaldrich.com/catalog/search/ProductDetail?ProdNo=G2795&Brand=SIGMA ω-Grammotoxin SIA from Grammostola spatulata venom, ≥98% (HPLC)
  2. Lampe . R. A. . Defeo . P. A. . Davison . M. D. . Young . J. . Herman . J. L. . Spreen . R. C. . Horn . M. B. . Mangano . T. J. . Keith . R. A. . Isolation and pharmacological characterization of omega-grammotoxin SIA, a novel peptide inhibitor of neuronal voltage-sensitive calcium channel responses . Molecular Pharmacology . 44 . 2 . 451–460 . 1993 . 8394998.
  3. McDonough . S. I. . Lampe . R. A. . Keith . R. A. . Bean . B. P. . Voltage-dependent inhibition of N- and P-type calcium channels by the peptide toxin omega-grammotoxin-SIA . Molecular Pharmacology . 52 . 6 . 1095–1104 . 1997 . 10.1124/mol.52.6.1095 . 9415720.