Euplotid nuclear code explained

The euplotid nuclear code (translation table 10) is the genetic code used by Euplotidae. The euplotid code is a socalled "symmetrical code", which results from the symmetrical distribution of the codons. This symmetry allows for arythmic exploration of the codon distribution. In 2013, shCherbak and Makukov, reported that "the patterns are shown to match the criteria of an intelligent signal."[1]

The code

   [[Amino acid|AAs]] = FFLLSSSSYY**CCCWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

[[Start codon|Starts]] = -----------------------------------M----------------------------

 [[DNA#Nucleobase_classification|Base1]] = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Systematic range

See also

References

[2]

Notes and References

  1. shCherbak . Vladimir I. . Makukov . Maxim A. . The 'Wow! signal' of the terrestrial genetic code . Icarus . May 2013 . 224 . 1 . 228–242 . 10.1016/j.icarus.2013.02.017 . 2013Icar..224..228S . 1303.6739 . 16507813 .
  2. Web site: Andrzej . Elzanowski . Jim . Ostell . Detlef . Leipe . Vladimir . Soussov . vanc . The Genetic Codes. 19 March 2016 . Taxonomy browser . National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine .