Big dynorphin explained

Big dynorphin is an endogenous opioid peptide of the dynorphin family that is composed of both dynorphin A and dynorphin B.[1] [2] Big dynorphin has the amino acid sequence: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr. It has nociceptive and anxiolytic-like properties, as well as effects on memory in mice.[3] [4]

Big dynorphin is a principal endogenous, agonist at the human kappa-opioid receptor.[5]

Notes and References

  1. Web site: Big dynorphin: Biological activity. IUPHAR/BPS Guide to PHARMACOLOGY . International Union of Basic and Clinical Pharmacology . 20 October 2017 . Principal endogenous agonists at κ receptor.
  2. Web site: Big dynorphin: Structure – Peptide Sequence. IUPHAR/BPS Guide to PHARMACOLOGY . International Union of Basic and Clinical Pharmacology . 20 October 2017 . Peptide sequence
    YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
    Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr.
  3. Kuzmin. Alexander. Madjid. Nather. Terenius. Lars. Ogren. Sven Ove. Bakalkin. Georgy. Big Dynorphin, a Prodynorphin-Derived Peptide Produces NMDA Receptor-Mediated Effects on Memory, Anxiolytic-Like and Locomotor Behavior in Mice. Neuropsychopharmacology. 31. 9. 2005. 1928–1937. 0893-133X. 10.1038/sj.npp.1300959. 16292317. free.
  4. Tan-No K, Esashi A, Nakagawasai O . Intrathecally administered big dynorphin, a prodynorphin-derived peptide, produces nociceptive behavior through an N-methyl-D-aspartate receptor mechanism . Brain Res. . 952 . 1 . 7–14 . 2002 . 12363399 . 10.1016/S0006-8993(02)03180-3. 1734522 . etal.
  5. Merg F, Filliol D, Usynin I . Big dynorphin as a putative endogenous ligand for the kappa-opioid receptor . J. Neurochem. . 97 . 1 . 292–301 . 2006 . 16515546 . 10.1111/j.1471-4159.2006.03732.x. etal. free .