SBP-tag explained
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies.
The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
Discovery
The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin.[1] The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM[2] [1] and is readily eluted with biotin under native conditions.[1]
Applications
Protein purification
Because of the mild elution conditions (biotin plus wash buffer) SBP-Tagged proteins can be generated in a relatively pure state with a single purification step.[2] [3] [4] There are several relatively abundant mammalian proteins that inherently associate with the IMAC matrices that bind to the more commonly used Polyhistidine-tag (His-tag). For this reason non-IMAC purification protocols, including with the SBP-Tag, are often preferred for proteins that are expressed in mammalian cells.
Protein complex purification
Complexes of interacting proteins may also be purified using the SBP-Tag because elution with biotin permits recovery under conditions in which desired complexes remain associated. For example, the Condensin Complex was purified by Kim et al. [2010] and complexes with the TAZ transcriptional co-activator were purified by Zhang et al. [2009]. The SBP-Tag has also been incorporated into several Tandem Affinity Purification (TAP) systems in which successive purification steps are utilized with multiple tags, for example GFP fusion proteins and BTK-protein complexes were purified using a TAP protocol with the SBP-Tag and the His-Tag,[5] [6] HDGF-protein complexes were purified using a TAP protocol with the SBP-Tag and with the FLAG-tag[7] and Wnt complexes were purified using a TAP protocol with the SBP-Tag and with the [Calmodulin-Tag].[8] TAP is generally used with protein complexes and several studies report significant improvements in purity and yield when the SBP-Tag TAP systems are compared to non-SBP-Tag systems.[9] [10] [11] Commercial TAP systems that use the SBP-Tag include the Interplay® Adenoviral and Mammalian TAP Systems sold by Agilent Technologies, similar products are sold by Sigma-Aldrich.[12]
Proteomics
Screens for biologically relevant protein-protein interactions have been performed using Tandem Affinity Purification (TAP) with the SBP-Tag and Protein A,[10] for interaction proteomics and transcription factor complexes with the SBP-Tag and Protein G,[10] [13] for proteins that interact with the Dengue Virus protein DENV-2 NS4A with the SBP-Tag and the Calmodulin Tag.[14] and for proteins that interact with protein phosphatase 2A (PP2A) with the SBP-Tag and the hemagglutinin (HA)-tag.[11]
Imaging
The SBP-Tag will also bind to streptavidin or streptavidin reagents in solution. Applications of these engineered associations include the visualization of specific proteins within living cells,[15] monitoring of the kinetics of the translation of individual proteins in an in vitro translation system,[16] control of the integration of a multi-spanning membrane protein into the endoplasmic reticulum by fusing the SBP-Tag to the N-terminal translocation sequence and then halting integration with streptavidin and restarting integration with biotin.[17] [18] Fluorescent streptavidin reagents (e.g. streptavidin-HRP) can be used to visualize the SBP-tag by immunoblotting of SDS-PAGE.[2] [19] [20] Additionally, antibodies to the SBP-tag are available commercially.
Surface plasmon resonance
The SBP-Tag has been used to reversibly immobilize recombinant proteins onto streptavidin-functionalized surfaces thereby permitting interaction assessment such as by surface plasmon resonance (SPR) techniques with re-use of the functionalized surface.[21] SPR has also been used to compare the SBP-Tag with other streptavidin-binding peptides such as Strep-tag.[22]
See also
Further reading
- 50 . 10.1186/1471-2091-11-50 . 3022668 . Streptavidin-Binding Peptide (SBP)-tagged SMC2 allows single-step affinity fluorescence, blotting or purification of the condensin complex . 2010 . Kim . Ji Hun . Chang . Tsz M . Graham . Alison N . Choo . K HA . Kalitsis . Paul . Hudson . Damien F . BMC Biochemistry . 11 . 21194474 . free .
- 13355–62 . 10.1074/jbc.M900843200 . 2679435 . TEAD Transcription Factors Mediate the Function of TAZ in Cell Growth and Epithelial-Mesenchymal Transition . 2009 . Zhang . Heng . Liu . Chen-Ying . Zha . Zheng-Yu . Zhao . Bin . Yao . Jun . Zhao . Shimin . Xiong . Yue . Lei . Qun-Ying . Guan . Kun-Liang . Journal of Biological Chemistry . 284 . 20 . 19324877 . free .
Notes and References
- 3750–5 . 10.1073/pnas.061028198 . 31124 . The use of mRNA display to select high-affinity protein-binding peptides . 2001 . Wilson . David S. . Anthony D. . Keefe . Jack W. . Szostak . Proceedings of the National Academy of Sciences . 98 . 7 . 11274392. 2001PNAS...98.3750W . free .
- 440–6 . 10.1006/prep.2001.1515 . One-Step Purification of Recombinant Proteins Using a Nanomolar-Affinity Streptavidin-Binding Peptide, the SBP-Tag . 2001 . Keefe . Anthony D. . Protein Expression and Purification . 23 . 3 . 11722181 . Wilson . David S. . Seelig . Burckhard . Szostak . Jack W..
- 2419–23 . 10.1016/j.febslet.2011.06.026 . Recombinant human cytoplasmic dynein heavy chain 1 and 2: Observation of dynein-2 motor activity in vitro . 2011 . Ichikawa . Muneyoshi . Watanabe . Yuta . Murayama . Takashi . Toyoshima . Yoko Yano . FEBS Letters . 585 . 15 . 21723285. 27909093 .
- 3542–7 . 10.1073/pnas.1014152108 . 3048136 . Trypanosome REH1 is an RNA helicase involved with the 3'-5' polarity of multiple gRNA-guided uridine insertion/deletion RNA editing . 2011 . Li . Feng . Herrera . Jeremy . Zhou . Sharleen . Maslov . Dmitri A. . Simpson . Larry . Proceedings of the National Academy of Sciences . 108 . 9 . 21321231. 2011PNAS..108.3542L . free .
- 140–9 . 10.1002/pro.546 . 3047070 . Highly efficient purification of protein complexes from mammalian cells using a novel streptavidin-binding peptide and hexahistidine tandem tag system: Application to Bruton's tyrosine kinase . 2011 . Li . Yifeng . Franklin . Sarah . Zhang . Michael J. . Vondriska . Thomas M. . Protein Science . 20 . 21080425 . 1.
- 10.1371/journal.pone.0003822 . Engineering a Novel Multifunctional Green Fluorescent Protein Tag for a Wide Variety of Protein Research . 2008 . Imhof . Axel . Kobayashi . Takuya . Morone . Nobuhiro . Kashiyama . Taku . Oyamada . Hideto . Kurebayashi . Nagomi . Murayama . Takashi . PLOS ONE . 3 . 12 . e3822 . 19048102 . 2585475. 2008PLoSO...3.3822K . free .
- 10.1016/j.jprot.2011.08.021 . Interactome study suggests multiple cellular functions of hepatoma-derived growth factor (HDGF) . 2011 . Zhao . Jian . Yu . Hongxiu . Lin . Ling . Tu . Jun . Cai . Lili . Chen . Yanmei . Zhong . Fan . Lin . Chengzhao . He . Fuchu . Yang . Pengyuan . Journal of Proteomics . 21907836 . 75 . 2 . 588–602. 8 .
- F685–92 . 10.1152/ajprenal.00358.2009 . Characterization of the kinase activity of a WNK4 protein complex . 2009 . Ahlstrom . Robert . Yu . Alan S. L. . AJP: Renal Physiology . 297 . 3 . 19587141 . 2739714.
- 18719405 . 2008 . Kyriakakis . Phillip P. . Tipping . Marla . Abed . Louka . Veraksa . Alexey . Tandem affinity purification in Drosophila: The advantages of the GS-TAP system . 2 . 4 . 229–35 . Fly . 10.4161/fly.6669 . free .
- 1013–9 . 10.1038/nmeth968 . An efficient tandem affinity purification procedure for interaction proteomics in mammalian cells . 2006 . Bürckstümmer . Tilmann . Bennett . Keiryn L . Preradovic . Adrijana . Schütze . Gregor . Hantschel . Oliver . Superti-Furga . Giulio . Bauch . Angela . Nature Methods . 3 . 12 . 17060908. 7069058 .
- 10.1038/msb.2008.75 . An integrated workflow for charting the human interaction proteome: Insights into the PP2A system . 2009 . Glatter . Timo . Wepf . Alexander . Aebersold . Ruedi . Gstaiger . Matthias . Molecular Systems Biology . 5 . 19156129 . 237 . 2644174 . 1.
- 1487–99 . 10.1007/s10529-011-0592-x . The tandem affinity purification technology: An overview . 2011 . Li . Yifeng . Biotechnology Letters . 33 . 8 . 21424840. 157683 .
- Book: 195–218 . 10.1007/978-1-61779-154-3_11 . 978-1-61779-153-6 . Isolation of Transcription Factor Complexes from Arabidopsis Cell Suspension Cultures by Tandem Affinity Purification . Plant Transcription Factors . Ling . Yuan . Sharyn E . Perry . Methods in Molecular Biology . 2011 . Van Leene . Jelle . Eeckhout . Dominique . Persiau . Geert . Van De Slijke . Eveline . Geerinck . Jan . Van Isterdael . Gert . Witters . Erwin . De Jaeger . Geert . 754 . 4 . 21720954.
- 17021–9 . 10.1074/jbc.M109.006239 . The Polypyrimidine Tract-binding Protein Is Required for Efficient Dengue Virus Propagation and Associates with the Viral Replication Machinery . 2009 . Azlinda . Anwar . K. M. . Leong . Mary L. . Ng . Justin J. H. . Chu . Mariano A. . Garcia-Blanco . Journal of Biological Chemistry . 284 . 25 . 19380576 . 2719340. free .
- Corey M. . McCann . Florence M. . Bareyre . Jeff W. . Lichtman . Joshua R. . Sanes . 16018556 . 2005 . Peptide tags for labeling membrane proteins in live cells with multiple fluorophores . 38 . 6 . 945–52 . BioTechniques . 10.2144/05386IT02. free .
- 9326–32 . 10.1021/ja9019947 . Real-Time Monitoring of Cell-Free Translation on a Quartz-Crystal Microbalance . 2009 . Takahashi . Shuntaro . Iida . Masaaki . Furusawa . Hiroyuki . Shimizu . Yoshihiro . Ueda . Takuya . Okahata . Yoshio . Journal of the American Chemical Society . 131 . 26 . 19518055.
- 1441–52 . 10.1083/jcb.200707050 . 2373506 . Two translocating hydrophilic segments of a nascent chain span the ER membrane during multispanning protein topogenesis . 2007 . Kida . Yuichiro . Morimoto . Fumiko . Sakaguchi . Masao . The Journal of Cell Biology . 179 . 7 . 18166653.
- 2861–6 . 10.1074/jbc.M808020200 . Signal Anchor Sequence Provides Motive Force for Polypeptide Chain Translocation through the Endoplasmic Reticulum Membrane . 2008 . Kida . Y. . Morimoto . F. . Sakaguchi . M. . Journal of Biological Chemistry . 284 . 5 . 19010775. free .
- 379–90 . 10.1042/BJ20081318 . Structural basis and specificity of human otubain 1-mediated deubiquitination . 2009 . Edelmann . Mariola J. . Iphöfer . Alexander . Akutsu . Masato . Altun . Mikael . Di Gleria . Katalin . Kramer . Holger B. . Fiebiger . Edda . Dhe-Paganon . Sirano . Kessler . Benedikt M. . Biochemical Journal . 418 . 2 . 18954305 .
- 45–51 . 10.1016/j.febslet.2006.11.075 . MARCH-IX mediates ubiquitination and downregulation of ICAM-1 . 2007 . Hoer . Simon . Smith . Lorraine . Lehner . Paul J. . FEBS Letters . 581 . 17174307 . 1. 22461058 .
- 1321–6 . 10.1007/s00216-006-0794-6 . Reversible immobilization of proteins with streptavidin affinity tags on a surface plasmon resonance biosensor chip . 2006 . Li . Yong-Jin . Bi . Li-Jun . Zhang . Xian-En . Zhou . Ya-Feng . Zhang . Ji-Bin . Chen . Yuan-Yuan . Li . Wei . Zhang . Zhi-Ping . Analytical and Bioanalytical Chemistry . 386 . 5 . 17006676. 6074268 .
- 435–9 . 10.1016/j.jbbm.2006.10.006 . Construction of a high sensitive Escherichia coli alkaline phosphatase reporter system for screening affinity peptides . 2007 . Huang . Xu . Zhang . Xian-En . Zhou . Ya-Feng . Zhang . Zhi-Ping . Cass . Anthony E. G. . Journal of Biochemical and Biophysical Methods . 70 . 3 . 17156847.