Ciliate, dasycladacean and hexamita nuclear code explained

The ciliate, dasycladacean and Hexamita nuclear code (translation table 6) is a genetic code used by certain ciliate, dasycladacean and Hexamita species.

The ciliate macronuclear code has not been determined completely. The codon UAA is known to code for Gln only in the Oxytrichidae.

The code

   [[Amino acid|AAs]] = FFLLSSSSYYQQCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

[[Start codon|Starts]] = -----------------------------------M----------------------------

 [[DNA#Nucleobase_classification|Base1]] = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V).

Systematic range

See also

References

[4]

External links

Notes and References

  1. Hoffman DC, Anderson RC, DuBois ML, Prescott DM . Macronuclear gene-sized molecules of hypotrichs . Nucleic Acids Research . 23 . 8 . 1279–83 . 1995 . 7753617 . 306850 . 10.1093/nar/23.8.1279 .
  2. Schneider SU, Leible MB, Yang XP . Strong homology between the small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase of two species of Acetabularia and the occurrence of unusual codon usage . Molecular & General Genetics . 218 . 3 . 445–52 . 1989 . 2573818 . 10.1007/bf00332408. 31247623 .
  3. Schneider SU, de Groot EJ . Sequences of two rbcS cDNA clones of Batophora oerstedii: structural and evolutionary considerations . Current Genetics . 20 . 1–2 . 173–5 . 1991 . 1934113 . 10.1007/bf00312782. 13509708 .
  4. Web site: Andrzej . Elzanowski . Jim . Ostell . Detlef . Leipe . Vladimir . Soussov . vanc . The Genetic Codes. 29 January 2016 . Taxonomy browser . National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine .