Blepharisma nuclear code explained

The Blepharisma nuclear code (translation table 15) is a genetic code found in the nuclei of Blepharisma.[1]

Code

   [[Amino acid|AAs]] = FFLLSSSSYY*QCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

[[Start codon|Starts]] = -----------------------------------M----------------------------

 [[DNA#Nucleobase_classification|Base1]] = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Systematic range and comments

Ciliata: Blepharisma[2]

See also

References

[3]

Notes and References

  1. Web site: The Genetic Codes . Andrzej Elzanowski . Jim Ostell . 26 September 1996 . National Center for Biotechnology Information . 20 January 2017 . https://web.archive.org/web/20160314155647/http://www.bioinformatics.org/JaMBW/2/3/TranslationTables.html#SG15 . 14 March 2016 . live .
  2. A Liang, K Heckman. 1993. Naturwissenschaften. 80. 225–226. Blepharisma uses UAA as a termination codon. 5. 10.1007/bf01175738. 7685500. 1993NW.....80..225L. 6219316.
  3. Web site: Andrzej . Elzanowski . Jim . Ostell . Detlef . Leipe . Vladimir . Soussov . vanc . The Genetic Codes. 3 July 2016 . Taxonomy browser . National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine .